Bacteria acpS protein

Artikelnummer: BYT-ORB595087
Artikelname: Bacteria acpS protein
Artikelnummer: BYT-ORB595087
Hersteller Artikelnummer: orb595087
Alternativnummer: BYT-ORB595087-20,BYT-ORB595087-100,BYT-ORB595087-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 4-phosphopantetheinyl transferase AcpS (Holo-ACP synthase)
This Bacteria acpS protein spans the amino acid sequence from region 1-118aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 17.1 kDa
UniProt: Q48RM7
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Streptococcus pyogenes serotype M28 (strain MGAS6180)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWAGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK
Anwendungsbeschreibung: Biological Origin: Streptococcus pyogenes serotype M28 (strain MGAS6180). Application Notes: Full Length
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M28 (strain MGAS6180) acpS.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M28 (strain MGAS6180) acpS.