Bacteria acpS protein

Catalog Number: BYT-ORB595087
Article Name: Bacteria acpS protein
Biozol Catalog Number: BYT-ORB595087
Supplier Catalog Number: orb595087
Alternative Catalog Number: BYT-ORB595087-20,BYT-ORB595087-100,BYT-ORB595087-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: 4-phosphopantetheinyl transferase AcpS (Holo-ACP synthase)
This Bacteria acpS protein spans the amino acid sequence from region 1-118aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 17.1 kDa
UniProt: Q48RM7
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Streptococcus pyogenes serotype M28 (strain MGAS6180)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWAGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK
Application Notes: Biological Origin: Streptococcus pyogenes serotype M28 (strain MGAS6180). Application Notes: Full Length
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M28 (strain MGAS6180) acpS.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M28 (strain MGAS6180) acpS.