Mouse Bgn protein

Artikelnummer: BYT-ORB603936
Artikelname: Mouse Bgn protein
Artikelnummer: BYT-ORB603936
Hersteller Artikelnummer: orb603936
Alternativnummer: BYT-ORB603936-20,BYT-ORB603936-100,BYT-ORB603936-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Bone/cartilage proteoglycan I (PG-S1)
This Mouse Bgn protein spans the amino acid sequence from region 38-369aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 43.4 kDa
UniProt: P28653
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DEEASGSDTTSGVPDLDSVTPTFSAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSR
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Bgn.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Bgn.