Mouse Bgn protein

Catalog Number: BYT-ORB603936
Article Name: Mouse Bgn protein
Biozol Catalog Number: BYT-ORB603936
Supplier Catalog Number: orb603936
Alternative Catalog Number: BYT-ORB603936-20,BYT-ORB603936-100,BYT-ORB603936-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Bone/cartilage proteoglycan I (PG-S1)
This Mouse Bgn protein spans the amino acid sequence from region 38-369aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 43.4 kDa
UniProt: P28653
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DEEASGSDTTSGVPDLDSVTPTFSAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSR
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Bgn.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Bgn.