Human CRX protein

Artikelnummer: BYT-ORB603992
Artikelname: Human CRX protein
Artikelnummer: BYT-ORB603992
Hersteller Artikelnummer: orb603992
Alternativnummer: BYT-ORB603992-1,BYT-ORB603992-100,BYT-ORB603992-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: CORD2
This Human CRX protein spans the amino acid sequence from region 1-299aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 39.3 kDa
UniProt: O43186
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MMAYMNPGPHYSVNALALSGPSVDLMHQAVPYPSAPRKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCRQQRQQQKQQQQPPGGQAKARPAKRKAGTSPRPSTDVCPDPLGISDSYSPPLPGPSGSPTTAVATVSIWSPASESPLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSG
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CRX.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CRX.