Human CRX protein

Catalog Number: BYT-ORB603992
Article Name: Human CRX protein
Biozol Catalog Number: BYT-ORB603992
Supplier Catalog Number: orb603992
Alternative Catalog Number: BYT-ORB603992-1,BYT-ORB603992-100,BYT-ORB603992-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: CORD2
This Human CRX protein spans the amino acid sequence from region 1-299aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 39.3 kDa
UniProt: O43186
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MMAYMNPGPHYSVNALALSGPSVDLMHQAVPYPSAPRKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCRQQRQQQKQQQQPPGGQAKARPAKRKAGTSPRPSTDVCPDPLGISDSYSPPLPGPSGSPTTAVATVSIWSPASESPLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSG
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CRX.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CRX.