Mouse Dbi protein

Artikelnummer: BYT-ORB604040
Artikelname: Mouse Dbi protein
Artikelnummer: BYT-ORB604040
Hersteller Artikelnummer: orb604040
Alternativnummer: BYT-ORB604040-1,BYT-ORB604040-100,BYT-ORB604040-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Diazepam-binding inhibitor (DBI) (Endozepine) (EP) (ACBP)
This Mouse Dbi protein spans the amino acid sequence from region 2-87aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 16.9 kDa
UniProt: P31786
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SQAEFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEKVDELKKKYGI
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Dbi.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Dbi.