Mouse Dbi protein

Catalog Number: BYT-ORB604040
Article Name: Mouse Dbi protein
Biozol Catalog Number: BYT-ORB604040
Supplier Catalog Number: orb604040
Alternative Catalog Number: BYT-ORB604040-1,BYT-ORB604040-100,BYT-ORB604040-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Diazepam-binding inhibitor (DBI) (Endozepine) (EP) (ACBP)
This Mouse Dbi protein spans the amino acid sequence from region 2-87aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 16.9 kDa
UniProt: P31786
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SQAEFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEKVDELKKKYGI
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Dbi.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Dbi.