Human HER2 protein

Artikelnummer: BYT-ORB604076
Artikelname: Human HER2 protein
Artikelnummer: BYT-ORB604076
Hersteller Artikelnummer: orb604076
Alternativnummer: BYT-ORB604076-1,BYT-ORB604076-100,BYT-ORB604076-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Metastatic lymph node gene 19 protein , MLN 19Proto-oncogene NeuProto-oncogene c-ErbB-2Tyrosine kinase-type cell surface receptor HER2p185erbB2, , CD340
This Human HER2 protein spans the amino acid sequence from region 153-598aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 53.1 kDa
UniProt: P04626
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEIT
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Partial
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ERBB2.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ERBB2.