Human HER2 protein

Catalog Number: BYT-ORB604076
Article Name: Human HER2 protein
Biozol Catalog Number: BYT-ORB604076
Supplier Catalog Number: orb604076
Alternative Catalog Number: BYT-ORB604076-1,BYT-ORB604076-100,BYT-ORB604076-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Metastatic lymph node gene 19 protein , MLN 19Proto-oncogene NeuProto-oncogene c-ErbB-2Tyrosine kinase-type cell surface receptor HER2p185erbB2, , CD340
This Human HER2 protein spans the amino acid sequence from region 153-598aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 53.1 kDa
UniProt: P04626
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEIT
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Partial
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ERBB2.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ERBB2.