Human IL3 protein

Artikelnummer: BYT-ORB604192
Artikelname: Human IL3 protein
Artikelnummer: BYT-ORB604192
Hersteller Artikelnummer: orb604192
Alternativnummer: BYT-ORB604192-1,BYT-ORB604192-100,BYT-ORB604192-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Interleukin-3, IL-3,Hematopoietic growth factor, Mast cell growth factor (MCGF), Multipotential colony-stimulating factor, P-cell-stimulating factor, IL3
This Human IL3 protein spans the amino acid sequence from region 20-152aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 22.0 kDa
UniProt: P08700
Puffer: Lyophilized from a 0.2 µm filtered PBS, 6% Trehalose, pH 7.4
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 5.972-17.16 ng/mL. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 5.972-17.16 ng/mL.



* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten
Verfügbarkeit
PER E-MAIL BESTELLEN
Produktgarantie und fachkundiger Support
BIOZOL