Human IL3 protein

Catalog Number: BYT-ORB604192
Article Name: Human IL3 protein
Biozol Catalog Number: BYT-ORB604192
Supplier Catalog Number: orb604192
Alternative Catalog Number: BYT-ORB604192-1,BYT-ORB604192-100,BYT-ORB604192-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Interleukin-3, IL-3,Hematopoietic growth factor, Mast cell growth factor (MCGF), Multipotential colony-stimulating factor, P-cell-stimulating factor, IL3
This Human IL3 protein spans the amino acid sequence from region 20-152aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 22.0 kDa
UniProt: P08700
Buffer: Lyophilized from a 0.2 µm filtered PBS, 6% Trehalose, pH 7.4
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 5.972-17.16 ng/mL. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 5.972-17.16 ng/mL.



* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL