Mouse Lum protein

Artikelnummer: BYT-ORB604234
Artikelname: Mouse Lum protein
Artikelnummer: BYT-ORB604234
Hersteller Artikelnummer: orb604234
Alternativnummer: BYT-ORB604234-1,BYT-ORB604234-100,BYT-ORB604234-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Keratan sulfate proteoglycan lumican (KSPG lumican) (Lcn) (Ldc)
This Mouse Lum protein spans the amino acid sequence from region 19-338aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 44.0 kDa
UniProt: P51885
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QYYDYDIPLFMYGQISPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLTNNKISKLGSFDGLVNLTFIYLQHNQLKEDAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKISNIPDEYFKRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVN
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Lum.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Lum.