Mouse Lum protein

Catalog Number: BYT-ORB604234
Article Name: Mouse Lum protein
Biozol Catalog Number: BYT-ORB604234
Supplier Catalog Number: orb604234
Alternative Catalog Number: BYT-ORB604234-1,BYT-ORB604234-100,BYT-ORB604234-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Keratan sulfate proteoglycan lumican (KSPG lumican) (Lcn) (Ldc)
This Mouse Lum protein spans the amino acid sequence from region 19-338aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 44.0 kDa
UniProt: P51885
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QYYDYDIPLFMYGQISPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLTNNKISKLGSFDGLVNLTFIYLQHNQLKEDAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKISNIPDEYFKRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVN
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Lum.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Lum.