Human NKX2-1 protein

Artikelnummer: BYT-ORB604272
Artikelname: Human NKX2-1 protein
Artikelnummer: BYT-ORB604272
Hersteller Artikelnummer: orb604272
Alternativnummer: BYT-ORB604272-1,BYT-ORB604272-100,BYT-ORB604272-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Homeobox protein NK-2 homolog A (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1) (Thyroid-specific enhancer-binding protein) (T/EBP) (NKX2A) (TITF1) (TTF1)
This Human NKX2-1 protein spans the amino acid sequence from region 1-371aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 46.0 kDa
UniProt: P43699
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSP
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NKX2-1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NKX2-1.