Human NKX2-1 protein

Catalog Number: BYT-ORB604272
Article Name: Human NKX2-1 protein
Biozol Catalog Number: BYT-ORB604272
Supplier Catalog Number: orb604272
Alternative Catalog Number: BYT-ORB604272-1,BYT-ORB604272-100,BYT-ORB604272-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Homeobox protein NK-2 homolog A (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1) (Thyroid-specific enhancer-binding protein) (T/EBP) (NKX2A) (TITF1) (TTF1)
This Human NKX2-1 protein spans the amino acid sequence from region 1-371aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 46.0 kDa
UniProt: P43699
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSP
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NKX2-1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NKX2-1.