Fungi Lentinula edodes Serine protease inhibitor protein

Artikelnummer: BYT-ORB604516
Artikelname: Fungi Lentinula edodes Serine protease inhibitor protein
Artikelnummer: BYT-ORB604516
Hersteller Artikelnummer: orb604516
Alternativnummer: BYT-ORB604516-1,BYT-ORB604516-100,BYT-ORB604516-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Serine protease inhibitor
This Fungi Lentinula edodes Serine protease inhibitor protein spans the amino acid sequence from region 1-142aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 20.0 kDa
UniProt: P81639
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Lentinula edodes (Shiitake mushroom) (Lentinus edodes)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SLETGRYLIHNGNNIVSRNLAEDRSLNPKRIVLLEPTDKIQLTWIIEKSGDEYILNNRGAPTAHIEDHVFALLIHQEGATKWSIEAVPRHGRNAYIIKGSDGKGWVAPDKAGEQIIYRTLIVGPSEPPTFPLNQVFQIIKLE
Anwendungsbeschreibung: Biological Origin: Lentinula edodes (Shiitake mushroom) (Lentinus edodes). Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Lentinula edodes (Shiitake mushroom) (Lentinus edodes).
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Lentinula edodes (Shiitake mushroom) (Lentinus edodes).