Fungi Lentinula edodes Serine protease inhibitor protein

Catalog Number: BYT-ORB604516
Article Name: Fungi Lentinula edodes Serine protease inhibitor protein
Biozol Catalog Number: BYT-ORB604516
Supplier Catalog Number: orb604516
Alternative Catalog Number: BYT-ORB604516-1,BYT-ORB604516-100,BYT-ORB604516-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Serine protease inhibitor
This Fungi Lentinula edodes Serine protease inhibitor protein spans the amino acid sequence from region 1-142aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 20.0 kDa
UniProt: P81639
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Lentinula edodes (Shiitake mushroom) (Lentinus edodes)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SLETGRYLIHNGNNIVSRNLAEDRSLNPKRIVLLEPTDKIQLTWIIEKSGDEYILNNRGAPTAHIEDHVFALLIHQEGATKWSIEAVPRHGRNAYIIKGSDGKGWVAPDKAGEQIIYRTLIVGPSEPPTFPLNQVFQIIKLE
Application Notes: Biological Origin: Lentinula edodes (Shiitake mushroom) (Lentinus edodes). Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Lentinula edodes (Shiitake mushroom) (Lentinus edodes).
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Lentinula edodes (Shiitake mushroom) (Lentinus edodes).