Bacteria troA protein

Artikelnummer: BYT-ORB604533
Artikelname: Bacteria troA protein
Artikelnummer: BYT-ORB604533
Hersteller Artikelnummer: orb604533
Alternativnummer: BYT-ORB604533-1,BYT-ORB604533-100,BYT-ORB604533-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Tromp-1 (troMP1)
This Bacteria troA protein spans the amino acid sequence from region 23-308aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 38.2 kDa
UniProt: P96116
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Treponema pallidum (strain Nichols)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: FGSKDAAADGKPLVVTTIGMIADAVKNIAQGDVHLKGLMGPGVDPHLYTATAGDVEWLGNADLILYNGLHLETKMGEVFSKLRGSRLVVAVSETIPVSQRLSLEEAEFDPHVWFDVKLWSYSVKAVYESLCKLLPGKTREFTQRYQAYQQQLDKLDAYVRRKAQSLPAERRVLVTAHDAFGYFSRAYGFEVKGLQGVSTASEASAHDMQELAAFIAQRKLPAIFIESSIPHKNVEALRDAVQARGHVVQIGGELF
Anwendungsbeschreibung: Biological Origin: Treponema pallidum (strain Nichols). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Treponema pallidum (strain Nichols) troA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Treponema pallidum (strain Nichols) troA.