Bacteria troA protein

Catalog Number: BYT-ORB604533
Article Name: Bacteria troA protein
Biozol Catalog Number: BYT-ORB604533
Supplier Catalog Number: orb604533
Alternative Catalog Number: BYT-ORB604533-1,BYT-ORB604533-100,BYT-ORB604533-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Tromp-1 (troMP1)
This Bacteria troA protein spans the amino acid sequence from region 23-308aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 38.2 kDa
UniProt: P96116
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Treponema pallidum (strain Nichols)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: FGSKDAAADGKPLVVTTIGMIADAVKNIAQGDVHLKGLMGPGVDPHLYTATAGDVEWLGNADLILYNGLHLETKMGEVFSKLRGSRLVVAVSETIPVSQRLSLEEAEFDPHVWFDVKLWSYSVKAVYESLCKLLPGKTREFTQRYQAYQQQLDKLDAYVRRKAQSLPAERRVLVTAHDAFGYFSRAYGFEVKGLQGVSTASEASAHDMQELAAFIAQRKLPAIFIESSIPHKNVEALRDAVQARGHVVQIGGELF
Application Notes: Biological Origin: Treponema pallidum (strain Nichols). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Treponema pallidum (strain Nichols) troA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Treponema pallidum (strain Nichols) troA.