Bacteria dsbA protein

Artikelnummer: BYT-ORB604587
Artikelname: Bacteria dsbA protein
Artikelnummer: BYT-ORB604587
Hersteller Artikelnummer: orb604587
Alternativnummer: BYT-ORB604587-1,BYT-ORB604587-100,BYT-ORB604587-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: DsDNA-binding protein A (rpbB)
This Bacteria dsbA protein spans the amino acid sequence from region 1-89aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 17.8 kDa
UniProt: P13320
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Enterobacteria phage T4 (Bacteriophage T4)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAKKEMVEFDEAIHGEDLAKFIKEASDHKLKISGYNELIKDIRIRAKDELGVDGKMFNRLLALYHKDNRDVFEAETEEVVELYDTVFSK
Anwendungsbeschreibung: Biological Origin: Enterobacteria phage T4 (Bacteriophage T4). Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T4 (Bacteriophage T4) dsbA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T4 (Bacteriophage T4) dsbA.