Bacteria dsbA protein

Catalog Number: BYT-ORB604587
Article Name: Bacteria dsbA protein
Biozol Catalog Number: BYT-ORB604587
Supplier Catalog Number: orb604587
Alternative Catalog Number: BYT-ORB604587-1,BYT-ORB604587-100,BYT-ORB604587-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: DsDNA-binding protein A (rpbB)
This Bacteria dsbA protein spans the amino acid sequence from region 1-89aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 17.8 kDa
UniProt: P13320
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Enterobacteria phage T4 (Bacteriophage T4)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAKKEMVEFDEAIHGEDLAKFIKEASDHKLKISGYNELIKDIRIRAKDELGVDGKMFNRLLALYHKDNRDVFEAETEEVVELYDTVFSK
Application Notes: Biological Origin: Enterobacteria phage T4 (Bacteriophage T4). Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T4 (Bacteriophage T4) dsbA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T4 (Bacteriophage T4) dsbA.