Recombinant Human TP53&S100P Heterodimer Protein

Artikelnummer: CSB-MP7721HU
Artikelname: Recombinant Human TP53&S100P Heterodimer Protein
Artikelnummer: CSB-MP7721HU
Hersteller Artikelnummer: CSB-MP7721HU
Alternativnummer: CSB-MP7721HU-1, CSB-MP7721HU-100, CSB-MP7721HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 123.2 kDa
Tag: C-terminal 10xHis-HSA-tagged
UniProt: P04637
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mammalian cell
Expression System: 1-393aa(TP53)&1-95aa(S100P)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTII
Anwendungsbeschreibung: Research Areas: Cancer. Endotoxin: Not test