Recombinant Human TP53&S100P Heterodimer Protein

Catalog Number: CSB-MP7721HU
Article Name: Recombinant Human TP53&S100P Heterodimer Protein
Biozol Catalog Number: CSB-MP7721HU
Supplier Catalog Number: CSB-MP7721HU
Alternative Catalog Number: CSB-MP7721HU-1, CSB-MP7721HU-100, CSB-MP7721HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 123.2 kDa
Tag: C-terminal 10xHis-HSA-tagged
UniProt: P04637
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 1-393aa(TP53)&1-95aa(S100P)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTII
Application Notes: Research Areas: Cancer. Endotoxin: Not test