Recombinant Human Protein NDRG1 (NDRG1)(S336D,T346D)

Artikelnummer: CSB-MP835678HU(M)
Artikelname: Recombinant Human Protein NDRG1 (NDRG1)(S336D,T346D)
Artikelnummer: CSB-MP835678HU(M)
Hersteller Artikelnummer: CSB-MP835678HU(M)
Alternativnummer: CSB-MP835678HU(M)-1, CSB-MP835678HU(M)-100, CSB-MP835678HU(M)-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Differentiation-related gene 1 protein,N-myc downstream-regulated gene 1 protein,Nickel-specific induction protein Cap43,Reducing agents and tunicamycin-responsive protein,Rit42
Molekulargewicht: 45.5 kDa
Tag: C-terminal 10xHis-tagged
UniProt: Q92597
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mammalian cell
Expression System: 2-394aa(S336D,T346D)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPAL
Anwendungsbeschreibung: Research Areas: Cancer. Endotoxin: Not test