Recombinant Human Protein NDRG1 (NDRG1)(S336D,T346D)

Catalog Number: CSB-MP835678HU(M)
Article Name: Recombinant Human Protein NDRG1 (NDRG1)(S336D,T346D)
Biozol Catalog Number: CSB-MP835678HU(M)
Supplier Catalog Number: CSB-MP835678HU(M)
Alternative Catalog Number: CSB-MP835678HU(M)-1, CSB-MP835678HU(M)-100, CSB-MP835678HU(M)-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Differentiation-related gene 1 protein,N-myc downstream-regulated gene 1 protein,Nickel-specific induction protein Cap43,Reducing agents and tunicamycin-responsive protein,Rit42
Molecular Weight: 45.5 kDa
Tag: C-terminal 10xHis-tagged
UniProt: Q92597
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 2-394aa(S336D,T346D)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPAL
Application Notes: Research Areas: Cancer. Endotoxin: Not test