Recombinant Human Interleukin-25 (IL25)

Artikelnummer: CSB-MP875653HU
Artikelname: Recombinant Human Interleukin-25 (IL25)
Artikelnummer: CSB-MP875653HU
Hersteller Artikelnummer: CSB-MP875653HU
Alternativnummer: CSB-MP875653HU-1, CSB-MP875653HU-100, CSB-MP875653HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Interleukin-17E
Molekulargewicht: 44.2 kDa
Tag: N-terminal hFc1-tagged and C-terminal 10xHis-tagged
UniProt: Q9H293
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mammalian cell
Expression System: 33-177aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
Anwendungsbeschreibung: Research Areas: Immunology. Endotoxin: Not test