Recombinant Human Interleukin-25 (IL25)

Catalog Number: CSB-MP875653HU
Article Name: Recombinant Human Interleukin-25 (IL25)
Biozol Catalog Number: CSB-MP875653HU
Supplier Catalog Number: CSB-MP875653HU
Alternative Catalog Number: CSB-MP875653HU-1, CSB-MP875653HU-100, CSB-MP875653HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Interleukin-17E
Molecular Weight: 44.2 kDa
Tag: N-terminal hFc1-tagged and C-terminal 10xHis-tagged
UniProt: Q9H293
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 33-177aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
Application Notes: Research Areas: Immunology. Endotoxin: Not test