BMP5 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
GTX03273
- Bilder (0)
| Artikelname: | BMP5 antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | GTX03273 |
| Hersteller Artikelnummer: | GTX03273 |
| Alternativnummer: | GTX03273-100 |
| Hersteller: | GeneTex |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, FC, IHC-P, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | bone morphogenetic protein 5 |
| Anwendungsbeschreibung: | WB: 0.1-0.5µg/ml. IHC-P: 0.5-1µg/ml. FCM: 1-3µg/1x106 cells. ELISA: 0.1-0.5µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications. |
Produktgarantie und fachkundiger Support
