BMP5 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: GTX03273
Artikelname: BMP5 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: GTX03273
Hersteller Artikelnummer: GTX03273
Alternativnummer: GTX03273-100
Hersteller: GeneTex
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, FC, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids.
Konjugation: Unconjugated
Alternative Synonym: bone morphogenetic protein 5
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
Molekulargewicht: 52
NCBI: 653
UniProt: P22003
Puffer: 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Sodium azide.
Formulierung: Liquid
Anwendungsbeschreibung: WB: 0.1-0.5µg/ml. IHC-P: 0.5-1µg/ml. FCM: 1-3µg/1x106 cells. ELISA: 0.1-0.5µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.