BMP5 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: GTX03273
Article Name: BMP5 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: GTX03273
Supplier Catalog Number: GTX03273
Alternative Catalog Number: GTX03273-100
Manufacturer: GeneTex
Host: Rabbit
Category: Antikörper
Application: ELISA, FC, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids.
Conjugation: Unconjugated
Alternative Names: bone morphogenetic protein 5
Clonality: Polyclonal
Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
Molecular Weight: 52
NCBI: 653
UniProt: P22003
Buffer: 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Sodium azide.
Form: Liquid
Application Notes: WB: 0.1-0.5µg/ml. IHC-P: 0.5-1µg/ml. FCM: 1-3µg/1x106 cells. ELISA: 0.1-0.5µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.