BMP5 antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
GTX03273
- Images (0)
| Article Name: | BMP5 antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | GTX03273 |
| Supplier Catalog Number: | GTX03273 |
| Alternative Catalog Number: | GTX03273-100 |
| Manufacturer: | GeneTex |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, FC, IHC-P, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids. |
| Conjugation: | Unconjugated |
| Alternative Names: | bone morphogenetic protein 5 |
| Application Notes: | WB: 0.1-0.5µg/ml. IHC-P: 0.5-1µg/ml. FCM: 1-3µg/1x106 cells. ELISA: 0.1-0.5µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications. |
Product Guarantee and Expert Support
