Kv1.3 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
GTX16637
- Bilder (0)
| Artikelname: | Kv1.3 antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | GTX16637 |
| Hersteller Artikelnummer: | GTX16637 |
| Alternativnummer: | GTX16637-50 |
| Hersteller: | GeneTex |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, IP, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 (Intracellular, C-terminus) of human KV1.3 (Accession : P22001). |
| Konjugation: | Unconjugated |
| Alternative Synonym: | potassium voltage-gated channel subfamily A member 3 , HGK5 , HLK3 , HPCN3 , HUKIII , KV1.3 , MK3 , PCN3 |
Produktgarantie und fachkundiger Support
