Kv1.3 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: GTX16637
Article Name: Kv1.3 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: GTX16637
Supplier Catalog Number: GTX16637
Alternative Catalog Number: GTX16637-50
Manufacturer: GeneTex
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 (Intracellular, C-terminus) of human KV1.3 (Accession : P22001).
Conjugation: Unconjugated
Alternative Names: potassium voltage-gated channel subfamily A member 3 , HGK5 , HLK3 , HPCN3 , HUKIII , KV1.3 , MK3 , PCN3
Clonality: Polyclonal
Concentration: 0.6 mg/ml (Please refer to the vial label for the specific concentration.)
Molecular Weight: 64
NCBI: 3738
UniProt: P22001
Buffer: PBS, 1% BSA, 5% Sucrose, 0.025% Sodium azide.
Form: Liquid