Kv1.3 antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
GTX16637
- Images (0)
| Article Name: | Kv1.3 antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | GTX16637 |
| Supplier Catalog Number: | GTX16637 |
| Alternative Catalog Number: | GTX16637-50 |
| Manufacturer: | GeneTex |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, IP, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 (Intracellular, C-terminus) of human KV1.3 (Accession : P22001). |
| Conjugation: | Unconjugated |
| Alternative Names: | potassium voltage-gated channel subfamily A member 3 , HGK5 , HLK3 , HPCN3 , HUKIII , KV1.3 , MK3 , PCN3 |
Product Guarantee and Expert Support
