Kv1.6 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
GTX16638
- Bilder (0)
| Artikelname: | Kv1.6 antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | GTX16638 |
| Hersteller Artikelnummer: | GTX16638 |
| Alternativnummer: | GTX16638-50 |
| Hersteller: | GeneTex |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | GST fusion protein with a sequence NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEASRERRSSYLPTPHRAYAEKRMLTEV, corresponding to amino acid residues 463-530 (Intracellular, C-terminus) of rat KV1.6 (Accession : P17659), (MW: 35 kDa.). |
| Konjugation: | Unconjugated |
| Alternative Synonym: | potassium voltage-gated channel subfamily A member 6 , Kv1.6 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml (Please refer to the vial label for the specific concentration.) |
| NCBI: | 64358 |
| Puffer: | PBS, 1% BSA, 5% Sucrose, 0.025% Sodium azide. |
| Formulierung: | Liquid |
Produktgarantie und fachkundiger Support
