Kv1.6 antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
GTX16638
- Images (0)
| Article Name: | Kv1.6 antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | GTX16638 |
| Supplier Catalog Number: | GTX16638 |
| Alternative Catalog Number: | GTX16638-50 |
| Manufacturer: | GeneTex |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | GST fusion protein with a sequence NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEASRERRSSYLPTPHRAYAEKRMLTEV, corresponding to amino acid residues 463-530 (Intracellular, C-terminus) of rat KV1.6 (Accession : P17659), (MW: 35 kDa.). |
| Conjugation: | Unconjugated |
| Alternative Names: | potassium voltage-gated channel subfamily A member 6 , Kv1.6 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml (Please refer to the vial label for the specific concentration.) |
| NCBI: | 64358 |
| Buffer: | PBS, 1% BSA, 5% Sucrose, 0.025% Sodium azide. |
| Form: | Liquid |
Product Guarantee and Expert Support
