AMH antibody [5/6], IgG1, Unconjugated, Mouse, Monoclonal

Artikelnummer: GTX42794
Artikelname: AMH antibody [5/6], IgG1, Unconjugated, Mouse, Monoclonal
Artikelnummer: GTX42794
Hersteller Artikelnummer: GTX42794
Alternativnummer: GTX42794-1
Hersteller: GeneTex
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, IHC-P, WB
Spezies Reaktivität: Human, Monkey, Mouse, Primate, Rat, Sheep
Immunogen: Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
Konjugation: Unconjugated
Alternative Synonym: anti-Mullerian hormone , MIF , MIS
Klonalität: Monoclonal
Klon-Bezeichnung: [5/6]
Molekulargewicht: 59
Isotyp: IgG1
NCBI: 268
UniProt: P03971
Puffer: Tissue culture supernatant, 0.1% Sodium azide.
Formulierung: Liquid
Anwendungsbeschreibung: IHC-P: 1/20-1/40. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.