AMH antibody [5/6], IgG1, Unconjugated, Mouse, Monoclonal
Artikelnummer:
GTX42794
- Bilder (0)
| Artikelname: | AMH antibody [5/6], IgG1, Unconjugated, Mouse, Monoclonal |
| Artikelnummer: | GTX42794 |
| Hersteller Artikelnummer: | GTX42794 |
| Alternativnummer: | GTX42794-1 |
| Hersteller: | GeneTex |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC, IHC-P, WB |
| Spezies Reaktivität: | Human, Monkey, Mouse, Primate, Rat, Sheep |
| Immunogen: | Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC) |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti-Mullerian hormone , MIF , MIS |
| Anwendungsbeschreibung: | IHC-P: 1/20-1/40. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications. |
Produktgarantie und fachkundiger Support
