AMH antibody [5/6], IgG1, Unconjugated, Mouse, Monoclonal

Catalog Number: GTX42794
Article Name: AMH antibody [5/6], IgG1, Unconjugated, Mouse, Monoclonal
Biozol Catalog Number: GTX42794
Supplier Catalog Number: GTX42794
Alternative Catalog Number: GTX42794-1
Manufacturer: GeneTex
Host: Mouse
Category: Antikörper
Application: IHC, IHC-P, WB
Species Reactivity: Human, Monkey, Mouse, Primate, Rat, Sheep
Immunogen: Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
Conjugation: Unconjugated
Alternative Names: anti-Mullerian hormone , MIF , MIS
Clonality: Monoclonal
Clone Designation: [5/6]
Molecular Weight: 59
Isotype: IgG1
NCBI: 268
UniProt: P03971
Buffer: Tissue culture supernatant, 0.1% Sodium azide.
Form: Liquid
Application Notes: IHC-P: 1/20-1/40. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.