beta 2 Defensin antibody [L12-4C-C2], N-term, IgG1, Unconjugated, Mouse, Monoclonal
Artikelnummer:
GTX43302
- Bilder (0)
| Artikelname: | beta 2 Defensin antibody [L12-4C-C2], N-term, IgG1, Unconjugated, Mouse, Monoclonal |
| Artikelnummer: | GTX43302 |
| Hersteller Artikelnummer: | GTX43302 |
| Alternativnummer: | GTX43302-100 |
| Hersteller: | GeneTex |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | ELISA |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic human beta-Defensin 2 (a.a. 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP). |
| Konjugation: | Unconjugated |
| Alternative Synonym: | defensin beta 4A , BD-2 , DEFB-2 , DEFB102 , DEFB2 , DEFB4 , HBD-2 , SAP1 |
| Klonalität: | Monoclonal |
| Konzentration: | Batch dependent (Please refer to the vial label for the specific concentration.) |
| Klon-Bezeichnung: | [L12-4C-C2] |
| Isotyp: | IgG1 |
| Sensitivitaet: | Synthetic human beta-Defensin 2 (a.a. 4-41). |
| NCBI: | 1673 |
| UniProt: | O15263 |
| Puffer: | 50mM Tris, no preservatives. |
| Formulierung: | Liquid |
Produktgarantie und fachkundiger Support
