beta 2 Defensin antibody [L12-4C-C2], N-term, IgG1, Unconjugated, Mouse, Monoclonal

Catalog Number: GTX43302
Article Name: beta 2 Defensin antibody [L12-4C-C2], N-term, IgG1, Unconjugated, Mouse, Monoclonal
Biozol Catalog Number: GTX43302
Supplier Catalog Number: GTX43302
Alternative Catalog Number: GTX43302-100
Manufacturer: GeneTex
Host: Mouse
Category: Antikörper
Application: ELISA
Species Reactivity: Human
Immunogen: Synthetic human beta-Defensin 2 (a.a. 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP).
Conjugation: Unconjugated
Alternative Names: defensin beta 4A , BD-2 , DEFB-2 , DEFB102 , DEFB2 , DEFB4 , HBD-2 , SAP1
Clonality: Monoclonal
Concentration: Batch dependent (Please refer to the vial label for the specific concentration.)
Clone Designation: [L12-4C-C2]
Isotype: IgG1
Sensitivity: Synthetic human beta-Defensin 2 (a.a. 4-41).
NCBI: 1673
UniProt: O15263
Buffer: 50mM Tris, no preservatives.
Form: Liquid
428,00 €
100 µg
* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL