Defensin beta 1 antibody [M11-14b-D10], N-term, IgG1, Unconjugated, Mouse, Monoclonal
Artikelnummer:
GTX43303
- Bilder (0)
| Artikelname: | Defensin beta 1 antibody [M11-14b-D10], N-term, IgG1, Unconjugated, Mouse, Monoclonal |
| Artikelnummer: | GTX43303 |
| Hersteller Artikelnummer: | GTX43303 |
| Alternativnummer: | GTX43303-10 |
| Hersteller: | GeneTex |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic human beta-Defensin 1 (a.a. 1-36) (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK). |
| Konjugation: | Unconjugated |
| Alternative Synonym: | defensin beta 1 , BD1 , DEFB-1 , DEFB101 , HBD1 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 mg/ml (Please refer to the vial label for the specific concentration.) |
| Klon-Bezeichnung: | [M11-14b-D10] |
| Molekulargewicht: | 7 |
| Isotyp: | IgG1 |
| Sensitivitaet: | Synthetic human beta-Defensin 1 (a.a. 1-36). |
| NCBI: | 1672 |
| UniProt: | P60022 |
| Puffer: | PBS, no preservatives. |
| Formulierung: | Liquid |
Produktgarantie und fachkundiger Support
