Defensin beta 1 antibody [M11-14b-D10], N-term, IgG1, Unconjugated, Mouse, Monoclonal
Catalog Number:
GTX43303
- Images (0)
| Article Name: | Defensin beta 1 antibody [M11-14b-D10], N-term, IgG1, Unconjugated, Mouse, Monoclonal |
| Biozol Catalog Number: | GTX43303 |
| Supplier Catalog Number: | GTX43303 |
| Alternative Catalog Number: | GTX43303-10 |
| Manufacturer: | GeneTex |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Synthetic human beta-Defensin 1 (a.a. 1-36) (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK). |
| Conjugation: | Unconjugated |
| Alternative Names: | defensin beta 1 , BD1 , DEFB-1 , DEFB101 , HBD1 |
| Clonality: | Monoclonal |
| Concentration: | 1 mg/ml (Please refer to the vial label for the specific concentration.) |
| Clone Designation: | [M11-14b-D10] |
| Molecular Weight: | 7 |
| Isotype: | IgG1 |
| Sensitivity: | Synthetic human beta-Defensin 1 (a.a. 1-36). |
| NCBI: | 1672 |
| UniProt: | P60022 |
| Buffer: | PBS, no preservatives. |
| Form: | Liquid |
Product Guarantee and Expert Support
