Polyclonal Rabbit anti-Human MKI67 / Ki67 Antibody (IF, WB) LS-C331889

Artikelnummer: LS-C331889-20
Artikelname: Polyclonal Rabbit anti-Human MKI67 / Ki67 Antibody (IF, WB) LS-C331889
Artikelnummer: LS-C331889-20
Hersteller Artikelnummer: LS-C331889-20
Alternativnummer: LS-C331889-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1200-1300 of human MKI67 (NP_001139438.1). QKLDLTENLTGSKRRLQTPKEKAQALEDLAGFKELFQTRGHTEESMTNDKTAKVACKSSQPDPDKNPASSKRRLKTSLGKVGVKEELLAVGKLTQTSGETT
Konjugation: Unconjugated
Alternative Synonym: MKI67, Antigen KI-67, Ki67, KIA
Ki67 antibody LS-C331889 is an unconjugated rabbit polyclonal antibody to human Ki67 (MKI67). Validated for IF and WB.
Klonalität: Polyclonal
NCBI: 4288
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: IF (1:50 - 1:100), WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 319kDa/358kDa, while the observed MW by Western blot was 360kDa.
Western blot analysis of extracts of HeLa cells.
Immunofluorescence analysis.