Polyclonal Rabbit anti-Human MKI67 / Ki67 Antibody (IF, WB) LS-C331889

Catalog Number: LS-C331889-20
Article Name: Polyclonal Rabbit anti-Human MKI67 / Ki67 Antibody (IF, WB) LS-C331889
Biozol Catalog Number: LS-C331889-20
Supplier Catalog Number: LS-C331889-20
Alternative Catalog Number: LS-C331889-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IF, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1200-1300 of human MKI67 (NP_001139438.1). QKLDLTENLTGSKRRLQTPKEKAQALEDLAGFKELFQTRGHTEESMTNDKTAKVACKSSQPDPDKNPASSKRRLKTSLGKVGVKEELLAVGKLTQTSGETT
Conjugation: Unconjugated
Alternative Names: MKI67, Antigen KI-67, Ki67, KIA
Ki67 antibody LS-C331889 is an unconjugated rabbit polyclonal antibody to human Ki67 (MKI67). Validated for IF and WB.
Clonality: Polyclonal
NCBI: 4288
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IF (1:50 - 1:100), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 319kDa/358kDa, while the observed MW by Western blot was 360kDa.
Western blot analysis of extracts of HeLa cells.
Immunofluorescence analysis.