Polyclonal Rabbit anti-Human Adiponectin Antibody (IHC, WB) LS-C332154

Artikelnummer: LS-C332154-100

Bilder (2)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human Adiponectin Antibody (IHC, WB) LS-C332154
Artikelnummer:	LS-C332154-100
Hersteller Artikelnummer:	LS-C332154-100
Alternativnummer:	LS-C332154-100
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	IHC, WB
Spezies Reaktivität:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 19-104 of human ADIPOQ (NP_004788.1). ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEP
Konjugation:	Unconjugated
Alternative Synonym:	ADIPOQ, Adiponectin, ADPN, ACDC, ADIPQTL1, APM-1, APM1, ACRP30, Gelatin-binding protein 28, GBP28, Gelatin-binding protein

Adiponectin antibody LS-C332154 is an unconjugated rabbit polyclonal antibody to Adiponectin from human. It is reactive with human, mouse and rat. Validated for IHC and WB.

Klonalität:	Polyclonal
NCBI:	9370
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 26kDa, while the observed MW by Western blot was 33kDa.

	Western blot analysis of extracts of various cell lines.
	Immunohistochemistry of paraffin-embedded mouse kidney tissue.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten