Recombinant fusion protein containing a sequence corresponding to amino acids 19-104 of human ADIPOQ (NP_004788.1). ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEP
Conjugation:
Unconjugated
Alternative Names:
ADIPOQ, Adiponectin, ADPN, ACDC, ADIPQTL1, APM-1, APM1, ACRP30, Gelatin-binding protein 28, GBP28, Gelatin-binding protein
Adiponectin antibody LS-C332154 is an unconjugated rabbit polyclonal antibody to Adiponectin from human. It is reactive with human, mouse and rat. Validated for IHC and WB.