Polyclonal Rabbit anti-Human Neuropeptide Y / NPY Antibody (IHC, WB) LS-C332403

Artikelnummer: LS-C332403-100

Bilder (2)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human Neuropeptide Y / NPY Antibody (IHC, WB) LS-C332403
Artikelnummer:	LS-C332403-100
Hersteller Artikelnummer:	LS-C332403-100
Alternativnummer:	LS-C332403-100
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	IHC, WB
Spezies Reaktivität:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human NPY (NP_000896.1). MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
Konjugation:	Unconjugated
Alternative Synonym:	NPY, Pro-neuropeptide Y, Neuropeptide Y, PYY4

NPY antibody LS-C332403 is an unconjugated rabbit polyclonal antibody to NPY (Neuropeptide Y) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.

Klonalität:	Polyclonal
NCBI:	4852
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	IHC (1:50 - 1:100), WB (1:500 - 1:1000)
Anwendungsbeschreibung:	The predicted MW is 10kDa, while the observed MW by Western blot was Refer to Figures.

	Western blot analysis of extracts of A549 cells.
	Immunohistochemistry of paraffin-embedded mouse lung metastasis.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten