Polyclonal Rabbit anti-Human Neuropeptide Y / NPY Antibody (IHC, WB) LS-C332403

Catalog Number: LS-C332403-100
Article Name: Polyclonal Rabbit anti-Human Neuropeptide Y / NPY Antibody (IHC, WB) LS-C332403
Biozol Catalog Number: LS-C332403-100
Supplier Catalog Number: LS-C332403-100
Alternative Catalog Number: LS-C332403-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human NPY (NP_000896.1). MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
Conjugation: Unconjugated
Alternative Names: NPY, Pro-neuropeptide Y, Neuropeptide Y, PYY4
NPY antibody LS-C332403 is an unconjugated rabbit polyclonal antibody to NPY (Neuropeptide Y) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Clonality: Polyclonal
NCBI: 4852
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IHC (1:50 - 1:100), WB (1:500 - 1:1000)
Application Notes: The predicted MW is 10kDa, while the observed MW by Western blot was Refer to Figures.
Western blot analysis of extracts of A549 cells.
Immunohistochemistry of paraffin-embedded mouse lung metastasis.