Polyclonal Rabbit anti-Human MLANA / Melan-A Antibody (IHC, IF, WB) LS-C334620

Artikelnummer: LS-C334620-100

Bilder (3)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human MLANA / Melan-A Antibody (IHC, IF, WB) LS-C334620
Artikelnummer:	LS-C334620-100
Hersteller Artikelnummer:	LS-C334620-100
Alternativnummer:	LS-C334620-100
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	IF, IHC, WB
Spezies Reaktivität:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 48-118 of human MLANA (NP_005502.1). CRRRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
Konjugation:	Unconjugated
Alternative Synonym:	MLANA, Antigen LB39-AA, Antigen SK29-AA, Melan-A, Protein Melan-A, MART-1, MART1, Melan A

Melan-A antibody LS-C334620 is an unconjugated rabbit polyclonal antibody to Melan-A (MLANA) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.

Klonalität:	Polyclonal
Konzentration:	1.45 mg/ml
NCBI:	2315
Puffer:	PBS, 50% glycerol, pH 7.3
Reinheit:	Affinity purified
Formulierung:	PBS, 50% glycerol, pH 7.3

Application Verdünnung:	IF (1:50 - 1:200), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 13kDa, while the observed MW by Western blot was 18kDa.

	Western blot analysis of extracts of various cell lines, using MLANA antibody.
	Immunohistochemistry of paraffin-embedded Human liver injury tissue.
	Immunofluorescence analysis of U2OS cells.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten