Recombinant fusion protein containing a sequence corresponding to amino acids 48-118 of human MLANA (NP_005502.1). CRRRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
Conjugation:
Unconjugated
Alternative Names:
MLANA, Antigen LB39-AA, Antigen SK29-AA, Melan-A, Protein Melan-A, MART-1, MART1, Melan A
Melan-A antibody LS-C334620 is an unconjugated rabbit polyclonal antibody to Melan-A (MLANA) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.