Polyclonal Rabbit anti-Human MLANA / Melan-A Antibody (IHC, IF, WB) LS-C334620

Catalog Number: LS-C334620-100
Article Name: Polyclonal Rabbit anti-Human MLANA / Melan-A Antibody (IHC, IF, WB) LS-C334620
Biozol Catalog Number: LS-C334620-100
Supplier Catalog Number: LS-C334620-100
Alternative Catalog Number: LS-C334620-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IF, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 48-118 of human MLANA (NP_005502.1). CRRRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
Conjugation: Unconjugated
Alternative Names: MLANA, Antigen LB39-AA, Antigen SK29-AA, Melan-A, Protein Melan-A, MART-1, MART1, Melan A
Melan-A antibody LS-C334620 is an unconjugated rabbit polyclonal antibody to Melan-A (MLANA) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Clonality: Polyclonal
Concentration: 1.45 mg/ml
NCBI: 2315
Buffer: PBS, 50% glycerol, pH 7.3
Purity: Affinity purified
Form: PBS, 50% glycerol, pH 7.3
Application Dilute: IF (1:50 - 1:200), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 13kDa, while the observed MW by Western blot was 18kDa.
Western blot analysis of extracts of various cell lines, using MLANA antibody.
Immunohistochemistry of paraffin-embedded Human liver injury tissue.
Immunofluorescence analysis of U2OS cells.