Polyclonal Rabbit anti-Human FLNB / TAP Antibody (IHC, WB) LS-C335245

Artikelnummer: LS-C335245-100

Bilder (2)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human FLNB / TAP Antibody (IHC, WB) LS-C335245
Artikelnummer:	LS-C335245-100
Hersteller Artikelnummer:	LS-C335245-100
Alternativnummer:	LS-C335245-100
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	IHC, WB
Spezies Reaktivität:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 1686-1785 of human FLNB (NP_001157789.1). PDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFA
Konjugation:	Unconjugated
Alternative Synonym:	FLNB, ABP-280, ABP-280 homolog, AOI, ABP-278, Actin binding protein 278, Actin-binding-like protein, Filamin homolog 1, FLN1L, FLN3, FH1, Filamin-3, LRS1, TAP, Thyroid autoantigen, Beta-filamin, Filamin B, beta, Filamin-B, FLN-B, TABP, Truncated ABP

TAP antibody LS-C335245 is an unconjugated rabbit polyclonal antibody to TAP (FLNB) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.

Klonalität:	Polyclonal
NCBI:	2317
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	IHC (1:20 - 1:50), WB (1:500 - 1:1000)
Anwendungsbeschreibung:	The predicted MW is 230-281kDa, while the observed MW by Western blot was 298kDa.

	Western blot analysis of extracts of HeLa cells.
	Immunohistochemistry of paraffin-embedded rat brain tissue.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten