Polyclonal Rabbit anti-Human FLNB / TAP Antibody (IHC, WB) LS-C335245

Catalog Number: LS-C335245-100
Article Name: Polyclonal Rabbit anti-Human FLNB / TAP Antibody (IHC, WB) LS-C335245
Biozol Catalog Number: LS-C335245-100
Supplier Catalog Number: LS-C335245-100
Alternative Catalog Number: LS-C335245-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1686-1785 of human FLNB (NP_001157789.1). PDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFA
Conjugation: Unconjugated
Alternative Names: FLNB, ABP-280, ABP-280 homolog, AOI, ABP-278, Actin binding protein 278, Actin-binding-like protein, Filamin homolog 1, FLN1L, FLN3, FH1, Filamin-3, LRS1, TAP, Thyroid autoantigen, Beta-filamin, Filamin B, beta, Filamin-B, FLN-B, TABP, Truncated ABP
TAP antibody LS-C335245 is an unconjugated rabbit polyclonal antibody to TAP (FLNB) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Clonality: Polyclonal
NCBI: 2317
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IHC (1:20 - 1:50), WB (1:500 - 1:1000)
Application Notes: The predicted MW is 230-281kDa, while the observed MW by Western blot was 298kDa.
Western blot analysis of extracts of HeLa cells.
Immunohistochemistry of paraffin-embedded rat brain tissue.